Gene Bio Systems
Recombinant Mouse Tumor necrosis factor receptor superfamily member 18(Tnfrsf18)
Recombinant Mouse Tumor necrosis factor receptor superfamily member 18(Tnfrsf18)
SKU:CSB-CF023975MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O35714
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACIFFLTTVQLGLHIWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP
Protein Names:Recommended name: Tumor necrosis factor receptor superfamily member 18 Alternative name(s): Glucocorticoid-induced TNFR-related protein CD_antigen= CD357
Gene Names:Name:Tnfrsf18 Synonyms:Gitr
Expression Region:20-228
Sequence Info:full length protein
