Recombinant Mouse Tumor necrosis factor ligand superfamily member 15 (Tnfsf15), partial (Active)

SKU: Q5UBV8

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: Q5UBV8

Gene Names: Tnfsf15

Alternative Name(s): TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitor Gene names

Abbreviation: Recombinant Mouse Tnfsf15 protein, partial (Active)

Organism: Mus musculus (Mouse)

Source: Mammalian cell

Expression Region: 61-252aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged

Target Protein Sequence: AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

MW: 24.3 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Tnfsf15 at 2 μg/mL can bind Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU). The EC50 is 1.671-2.506 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis.

Reference: TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator. Migone T.-S., Zhang J., Luo X., Zhuang L., Chen C., Hu B., Hong J.S., Perry J.W., Chen S.-F., Wei P. Immunity 16: 479-492 (2002)

Function: