Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Sugar transporter SWEET1(Slc50a1)

Recombinant Mouse Sugar transporter SWEET1(Slc50a1)

SKU:CSB-CF875152MO

Regular price €1.504,95 EUR
Regular price Sale price €1.504,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9CXK4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEAGGVADSFLSSACVLFTLGMFSTGLSDLRHMQRTRSVDNIQFLPFLTTDVNNLSWLSY GVLKGDGTLIIVNSVGAVLQTLYILAYLHYSPQKHGVLLQTATLLAVLLLGYGYFWLLVP DLEARLQQLGLFCSVFTISMYLSPLADLAKIVQTKSTQRLSFSLTIATLFCSASWSIYGF RLRDPYITVPNLPGILTSLIRLGLFCKYPPEQDRKYRLLQT

Protein Names:Recommended name: Sugar transporter SWEET1 Short name= MmSWEET1 Alternative name(s): RAG1-activating protein 1 Solute carrier family 50 member 1

Gene Names:Name:Slc50a1 Synonyms:Rag1ap1, Rga

Expression Region:1-221

Sequence Info:full length protein

View full details