Gene Bio Systems
Recombinant Mouse Small proline-rich protein 2B(Sprr2b)
Recombinant Mouse Small proline-rich protein 2B(Sprr2b)
SKU:CSB-BP022613MO
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:O70554
Gene Names:Sprr2b
Organism:Mus musculus (Mouse)
AA Sequence:MSYYQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK
Expression Region:1-98aa
Sequence Info:Full Length
Source:Baculovirus
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:14.7 kDa
Alternative Name(s):Sprr2bSmall proline-rich protein 2B
Relevance:Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane
Reference:"Mouse Sprr2 genes: a clustered family of genes showing differential expression in epithelial tissues." Song H.J., Poy G., Darwiche N., Lichti U., Kuroki T., Steinert P.M., Kartasova T. Genomics 55:28-42(1999)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).
Involvement in disease:
Subcellular Location:Cytoplasm
Protein Families:Cornifin (SPRR) family
Tissue Specificity:Expressed in uterus.
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=445310
KEGG Database Link:
STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000058131
OMIM Database Link:
Lead Time Guidance:28-38 business days
