Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Serum amyloid A-1 protein(Saa1)

Recombinant Mouse Serum amyloid A-1 protein(Saa1)

SKU:CSB-EP020656MO

Regular price €776,95 EUR
Regular price Sale price €776,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: Saa1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P05366

AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-122aa

Protein length: Full Length of Mature Protein

MW: 27.8 kDa

Alternative Name(s):

Relevance: Major acute phase protein

Reference: "Complete primary structures of two major murine serum amyloid A proteins deduced from cDNA sequences."Yamamoto K., Migita S.Proc. Natl. Acad. Sci. U.S.A. 82:2915-2919(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details