Recombinant Mouse Protein Wnt-7b(Wnt7b)

Recombinant Mouse Protein Wnt-7b(Wnt7b)

CSB-EP026142MO
Regular price
€559,95 EUR
Sale price
€559,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Stem Cells

Uniprot ID: P28047

Gene Names: Wnt7b

Organism: Mus musculus (Mouse)

AA Sequence: ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK

Expression Region: 25-349aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 56.3 kDa

Alternative Name(s): Wnt-7b

Relevance: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.

Reference: "Fine mapping of the friend retrovirus resistance gene, Rfv3, on mouse chromosome 15." Super H.J., Hasenkrug K.J., Simmons S., Brooks D.M., Konzek R., Sarge K.D., Morimoto R.I., Jenkins N.A., Gilbert D.J., Copeland N.G., Frankel W., Chesebro B. J. Virol. 73:7848-7852(1999)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share