Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Protein tyrosine phosphatase receptor type C-associated protein(Ptprcap)

Recombinant Mouse Protein tyrosine phosphatase receptor type C-associated protein(Ptprcap)

SKU:CSB-CF737378MO

Regular price €1.481,95 EUR
Regular price Sale price €1.481,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q64697

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALPGTLRFGVLMALPGALASGADPEDGVGSSVVTIVLLLLLLLLLVTALALAWRRLSHA SGGYYHPARLGAALWGHTCRLLWASPAGRWLRARTELESPEESGPPEDEEDAEDFVIDGG PEEAAAKEEEQRCQAEQTRDPRDTDSDGGLGLSSQGPVGSGSSAEALLSDLHAFSGSAAW DDSAGGAGGQGLRVTAL

Protein Names:Recommended name: Protein tyrosine phosphatase receptor type C-associated protein Short name= PTPRC-associated protein Alternative name(s): CD45-associated protein Short name= CD45-AP LSM-1

Gene Names:Name:Ptprcap

Expression Region:1-197

Sequence Info:full length protein

View full details