
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Cardiovascular
Target / Protein: Jag1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: Q9QXX0
AA Sequence: GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 33-334AA
Protein length: Partial
MW: 53.6 kDa
Alternative Name(s): CD_antigen: CD339
Relevance: Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation. May regulate fibroblast growth factor-induced angiogenesis.
Reference: "The expression of Jagged1 in the developing mammalian heart correlates with cardiovascular disease in Alagille syndrome." Loomes K.M., Underkoffler L.A., Morabito J., Gottlieb S., Piccoli D.A., Spinner N.B., Baldwin H.S., Oakey R.J. Hum. Mol. Genet. 8:2443-2449(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Protein jagged-1(Jag1),partial
- Regular price
- €638,95 EUR
- Sale price
- €638,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Calreticulin(Calr)
- Regular price
- €636,95 EUR
- Sale price
- €636,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Annexin A1(Anxa1)
- Regular price
- €638,95 EUR
- Sale price
- €638,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Plexin domain-containing protein 1(Plxdc1),partial
- Regular price
- €724,95 EUR
- Sale price
- €724,95 EUR
- Regular price
-
- Unit price
- per
Sold out