Gene Bio Systems
Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 subunit C2(Ndufc2)
Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 subunit C2(Ndufc2)
SKU:CSB-CF863413MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9CQ54
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRMRPVMRAGLHR QLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 subunit C2 Alternative name(s): Complex I-B14.5b Short name= CI-B14.5b NADH-ubiquinone oxidoreductase subunit B14.5b
Gene Names:Name:Ndufc2
Expression Region:1-120
Sequence Info:full length protein
![Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 subunit C2(Ndufc2)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_26df1077-5748-41ae-9bda-2c55f6e02e20.jpg?v=1659246694&width=1445)