Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse NACHT, LRR and PYD domains-containing protein 3(Nlrp3),partial

Recombinant Mouse NACHT, LRR and PYD domains-containing protein 3(Nlrp3),partial

SKU:CSB-EP823181MO

Regular price €1.026,95 EUR
Regular price Sale price €1.026,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q8R4B8

Gene Names: Nlrp3

Organism: Mus musculus (Mouse)

AA Sequence: MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR

Expression Region: 1-153aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 34.2 kDa

Alternative Name(s): Cold autoinflammatory syndrome 1 protein homolog Cryopyrin Mast cell maturation-associated-inducible protein 1 PYRIN-containing APAF1-like protein 1

Relevance: May function as an inducer of apoptosis. Interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling. Inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA (By similarity). Activates caspase-1 as part of the NALP3 inflammasome complex in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18.

Reference: "Induction of PYPAF1 during in vitro maturation of mouse mast cells."Kikuchi-Yanoshita R., Taketomi Y., Koga K., Sugiki T., Atsumi Y., Saito T., Ishii S., Hisada M., Suzuki-Nishimura T., Uchida M.K., Moon T.-C., Chang H.-W., Sawada M., Inagaki N., Nagai H., Murakami M., Kudo I.J. Biochem. 134:699-709(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details