Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

SKU:CSB-YP717533MO

Regular price €772,95 EUR
Regular price Sale price €772,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: Ly6e

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: Q64253

AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-102aa

Protein length: Full Length of Mature Protein

MW: 24.8 kDa

Alternative Name(s): Stem cell antigen 2 Thymic shared antigen 1 Short name: TSA-1

Relevance: Involved in T-cell development.

Reference: "Mouse stem cell antigen Sca-2 is a member of the Ly-6 family of cell surface proteins."Classon B.J., Coverdale L.Proc. Natl. Acad. Sci. U.S.A. 91:5296-5300(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details