Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

CSB-EP717533MO
Regular price
€629,95 EUR
Sale price
€629,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Immunology

Target / Protein: Ly6e

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: Q64253

AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Tag info: N-terminal 6xHis-B2M-tagged

Expression Region: 21-102aa

Protein length: Full Length

MW: 22.8 kDa

Alternative Name(s): Stem cell antigen 2 Thymic shared antigen 1

Relevance: Involved in T-cell development.

Reference: "Characterization of Ly-6M, a novel member of the Ly-6 family of hematopoietic proteins." Patterson J.M.M., Johnson M.H., Zimonjic D.B., Graubert T.A. Blood 95:3125-3132(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share