Recombinant Mouse Lymphocyte antigen 6C1(Ly6c1)

Recombinant Mouse Lymphocyte antigen 6C1(Ly6c1)

CSB-YP317813MOa4
Regular price
€556,95 EUR
Sale price
€556,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: Ly6c1

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P0CW02

AA Sequence: LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG

Tag info: N-terminal 6xHis-SUMOSTAR-tagged

Expression Region: 27-109aa

Protein length: Full Length of Mature Protein

MW: 25.1 kDa

Alternative Name(s):

Relevance:

Reference: "B cells express Ly-6C in a Th1 but not Th2 cytokine environment." Schlueter A.J., Krieg A.M., De Vries P., Li X. J. Interferon Cytokine Res. 22:799-806(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share