Gene Bio Systems
Recombinant Mouse Leptin receptor overlapping transcript-like 1(Leprotl1)
Recombinant Mouse Leptin receptor overlapping transcript-like 1(Leprotl1)
SKU:CSB-CF012876MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9CQ74
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPVVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW
Protein Names:Recommended name: Leptin receptor overlapping transcript-like 1
Gene Names:Name:Leprotl1
Expression Region:1-131
Sequence Info:full length protein
