Gene Bio Systems
Recombinant Mouse L-selectin(Sell)
Recombinant Mouse L-selectin(Sell)
SKU:CSB-CF020977MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P18337
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFLIWLARRLKKGKKSQERMDDPY
Protein Names:Recommended name: L-selectin Alternative name(s): CD62 antigen-like family member L Leukocyte adhesion molecule 1 Short name= LAM-1 Leukocyte-endothelial cell adhesion molecule 1 Short name= LECAM1 Lymph node homing receptor Lymphocyte antigen 22 Short name= Ly-22 Lymphocyte surface MEL-14 antigen CD_antigen= CD62L
Gene Names:Name:Sell Synonyms:Lnhr, Ly-22, Ly22
Expression Region:39-372
Sequence Info:full length protein
