Gene Bio Systems
Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1(Klrg1)
Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1(Klrg1)
SKU:CSB-CF012472MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O88713
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADSSIYSTLELPEAPQVQDESRWKLKAVLHRPHLSRFAMVALGLLTVILMSLLMYQRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
Protein Names:Recommended name: Killer cell lectin-like receptor subfamily G member 1 Alternative name(s): Mast cell function-associated antigen 2F1
Gene Names:Name:Klrg1 Synonyms:Mafa
Expression Region:1-188
Sequence Info:full length protein
