Gene Bio Systems
Recombinant Mouse Interferon-induced transmembrane protein 1(Ifitm1)
Recombinant Mouse Interferon-induced transmembrane protein 1(Ifitm1)
SKU:CSB-CF863485MO-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9D103
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSV KSRDRKMVGDTTGAQAFASTAKCLNISSLFFTILTAIVVIVVCAIR
Protein Names:Recommended name: Interferon-induced transmembrane protein 1 Alternative name(s): Fragilis protein 2 Mouse ifitm-like protein 2 Short name= Mil-2
Gene Names:Name:Ifitm1
Expression Region:1-106
Sequence Info:full length protein
