Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Integral membrane protein 2B(Itm2b)

Recombinant Mouse Integral membrane protein 2B(Itm2b)

SKU:CSB-CF011904MO

Regular price €1.547,95 EUR
Regular price Sale price €1.547,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O89051

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKVTFNSALAQKEAKKDEPKSSEEALIVPPDAVAVDCKDPGDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGLKYIKDDVILNEPSADAPAARYQTIEENIKIFEEDAVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPKNLLELLINIKAGTYLPQSYLIHEHMVITDRIENVDNLGFFIYRLCHDKETYKLQRRETIRGIQKREASNCFTIRHFENKFAVETLICS

Protein Names:Recommended name: Integral membrane protein 2B Alternative name(s): Immature BRI2 Short name= imBRI2 Protein E25B Transmembrane protein BRI Short name= Bri Cleaved into the following 4 chains: 1. BRI2, membrane form Alternative name(s): Mature BRI2 Short name= mBRI2 BRI2 intracellular domain Short name= BRI2 ICD BRI2C, soluble form Bri23 peptide Short name= Bri2-23 Alternative name(s): ABri23 C-terminal peptide P23 peptide

Gene Names:Name:Itm2b

Expression Region:1-266

Sequence Info:full length protein

View full details