Gene Bio Systems
Recombinant Mouse Immunoglobulin superfamily member 6(Igsf6)
Recombinant Mouse Immunoglobulin superfamily member 6(Igsf6)
SKU:CSB-CF011564MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P0C6B7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CTVYVLQPGYLEVDYGSDAVTMECNFSTVGCPPVPPKSLWFRCGTHQPEALCLDGCRNEADKFTVKETLDPDQVFLTVNRLSPNDSAIYICGIAFPNELSPSAKHVGKGTTLVVRERLFSKEVRSFLIVLLALLSVYITGVCVTFIVLFKSKSNGPRSRETKGSKKKSARRIFQEIAQELYHKRYVETSHLPEQEGTDENRKALPNPGRA
Protein Names:Recommended name: Immunoglobulin superfamily member 6 Short name= IgSF6
Gene Names:Name:Igsf6
Expression Region:28-237
Sequence Info:full length protein
