Gene Bio Systems
Recombinant Mouse H-2 class II histocompatibility antigen gamma chain(Cd74) ,partial
Recombinant Mouse H-2 class II histocompatibility antigen gamma chain(Cd74) ,partial
SKU:CSB-EP004956MO
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P04441
Gene Names: Cd74
Organism: Mus musculus (Mouse)
AA Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
Expression Region: 56-279aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 29.4 kDa
Alternative Name(s): Ia antigen-associated invariant chain ;IiMHC class II-associated invariant chain; CD74
Relevance: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.
Reference: The phagosomal proteome in interferon-gamma-activated macrophages.Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.Immunity 30:143-154(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
