
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Cell Biology
Target / Protein: Gzma
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P11032
AA Sequence: IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
Tag info: N-terminal 6xHis-B2M-tagged
Expression Region: 29-260aa
Protein length: Full Length
MW: 39.6 kDa
Alternative Name(s): Autocrine thymic lymphoma granzyme-like serine protease CTLA-3 Fragmentin-1 T cell-specific serine protease 1
Relevance: Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA
Reference: "Genomic organization of the mouse granzyme A gene. Two mRNAs encode the same mature granzyme A with different leader peptides." Hershberger R.J., Gershenfeld H.K., Weissman I.L., Su L. J. Biol. Chem. 267:25488-25493(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Granzyme A(Gzma)
- Regular price
- €637,95 EUR
- Sale price
- €637,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Granzyme K(Gzmk)
- Regular price
- €736,95 EUR
- Sale price
- €736,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Tyrosine-protein kinase Lyn(Lyn)
- Regular price
- €637,95 EUR
- Sale price
- €637,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)
- Regular price
- €439,95 EUR
- Sale price
- €439,95 EUR
- Regular price
-
- Unit price
- per
Sold out