
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P33766
Gene Names: Fpr1
Organism: Mus musculus (Mouse)
AA Sequence: MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV
Expression Region: 1-35aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
MW: 33.7 kDa
Alternative Name(s): N-formyl peptide receptor Short name: FPR N-formylpeptide chemoattractant receptor
Relevance: High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Reference: "Species and subtype variants of the N-formyl peptide chemotactic receptor reveal multiple important functional domains." Gao J.-L., Murphy P.M. J. Biol. Chem. 268:25395-25401(1993)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human fMet-Leu-Phe receptor(FPR1),partial
- Regular price
- €920,95 EUR
- Sale price
- €920,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Formyl peptide receptor 2(Fpr2),partial
- Regular price
- €920,95 EUR
- Sale price
- €920,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse fMet-Leu-Phe receptor(Fpr1)
- Regular price
- €1.484,95 EUR
- Sale price
- €1.484,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human fMet-Leu-Phe receptor(FPR1)
- Regular price
- €1.471,95 EUR
- Sale price
- €1.471,95 EUR
- Regular price
-
- Unit price
- per
Sold out