GeneBio Systems
Recombinant Mouse Fibronectin type III domain-containing protein 5 (Fndc5), partial
Recombinant Mouse Fibronectin type III domain-containing protein 5 (Fndc5), partial
SKU:Q8K4Z2
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cell Biology
Uniprot ID: Q8K4Z2
Gene Names: Fndc5
Alternative Name(s): (Fibronectin type III repeat-containing protein 2)(Peroxisomal protein)(PeP)
Abbreviation: Recombinant Mouse Fndc5 protein, partial
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 29-140aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE
MW: 18.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: [Irisin]: Mediates beneficial effects of muscular exercise. Induces browning of white adipose tissue by stimulating UCP1 expression, at least in part, via the nuclear receptor PPARA.
Reference: "A PGC1-alpha-dependent myokine that drives brown-fat-like development of white fat and thermogenesis." Bostrom P., Wu J., Jedrychowski M.P., Korde A., Ye L., Lo J.C., Rasbach K.A., Bostrom E.A., Choi J.H., Long J.Z., Kajimura S., Zingaretti M.C., Vind B.F., Tu H., Cinti S., Hojlund K., Gygi S.P., Spiegelman B.M. Nature 481: 463-468(2012)
Function:
