Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse F-box-WD repeat-containing protein 10(Fbxw10),partial

Recombinant Mouse F-box-WD repeat-containing protein 10(Fbxw10),partial

SKU:CSB-EP725549MO

Regular price €1.017,95 EUR
Regular price Sale price €1.017,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q5SUS0

Gene Names: Fbxw10

Organism: Mus musculus (Mouse)

AA Sequence: VKWQYSSDKNKVKKSKDKEEEREETSLGDEHSRSTIQGHSLKDSVSSKQEFSKSRVHLKQTKNLSSDDMETPVGEVSHPLQKLWKVPMTPDRFLLTISALQQAHNSEEFAYPHRPRPQVIDAWGPSIPYPRKVLSLKGKSVQHAVDQLRSSNLPTGVRQTNIPLEIQKLQPNLKKSLHSPRVQATVPQPSLIRPKVSDSLRGDEHLTSSIDGTMRRAGPLTSMQVIKPNRMLAPRGGTATLSPKKERPRFYTTLDPLRMNTGFMLMTVKEEKEFAEAKMKEYEASVSTKEVDPGKASKAAWIRKIKGLPIDNFMKEGKTAAPELGQNVFI

Expression Region: 701-1030aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 53.2 kDa

Alternative Name(s): F-box and WD-40 domain-containing protein 10

Relevance: Probable substrate-recognition component of a SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Overexpression is leading to degradation of CBX5 and CBX1 (By similarity).

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details