Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse Creatine kinase M-type (Ckm)

Recombinant Mouse Creatine kinase M-type (Ckm)

SKU:P07310

Regular price €844,95 EUR
Regular price Sale price €844,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Metabolism

Uniprot ID: P07310

Gene Names: Ckm

Alternative Name(s): (Creatine kinase M chain)(Creatine phosphokinase M-type)(CPK-M)(M-CK)

Abbreviation: Recombinant Mouse Ckm protein

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 1-381aa

Protein Length: Full Length

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: MPFGNTHNKFKLNYKPQEEYPDLSKHNNHMAKVLTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

MW: 49.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Reference: "Activation time of myocardial oxidative phosphorylation in creatine kinase and adenylate kinase knockout mice." Gustafson L.A., Van Beek J.H. Am J Physiol Heart Circ Physiol 282: H2259-64(2002)

Function:

View full details