Gene Bio Systems
Recombinant Mouse Complement receptor type 2(Cr2),partial
Recombinant Mouse Complement receptor type 2(Cr2),partial
SKU:CSB-EP005934MO(F2)
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P19070
Gene Names: Cr2
Organism: Mus musculus (Mouse)
AA Sequence: ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE
Expression Region: 12-145aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 18.7 kDa
Alternative Name(s): Complement C3d receptor CD_antigen: CD21
Relevance: Receptor for complement C3d. Participates in B lymphocytes activation.
Reference: "Comparative structure and evolution of murine CR2. The homolog of the human C3d/EBV receptor (CD21)."Fingeroth J.D.J. Immunol. 144:3458-3467(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
