Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Claudin-4(Cldn4)

Recombinant Mouse Claudin-4(Cldn4)

SKU:CSB-CF005506MO

Regular price €1.492,95 EUR
Regular price Sale price €1.492,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O35054

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASMGLQVLGISLAVLGWLGIILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTG QMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKIMIT AGAVFIVASMLIMVPVSWTAHNVIRDFYNPMVASGQKREMGASLYVGWAASGLLLLGGGL LCCSCPPRSNDKPYSAKYSAARSVPASNYV

Protein Names:Recommended name: Claudin-4 Alternative name(s): Clostridium perfringens enterotoxin receptor Short name= CPE-R Short name= CPE-receptor

Gene Names:Name:Cldn4 Synonyms:Cper, Cpetr1

Expression Region:1-210

Sequence Info:Full length protein

View full details