Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse CD81 antigen(Cd81),partial

Recombinant Mouse CD81 antigen(Cd81),partial

SKU:CSB-EP004960MO

Regular price €774,95 EUR
Regular price Sale price €774,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P35762

Gene Names: Cd81

Organism: Mus musculus (Mouse)

AA Sequence: KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK

Expression Region: 116-201aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 36.4 kDa

Alternative Name(s): 26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1; CD81

Relevance: May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.

Reference: Possible involvement of CD81 in acrosome reaction of sperm in mice.Tanigawa M., Miyamoto K., Kobayashi S., Sato M., Akutsu H., Okabe M., Mekada E., Sakakibara K., Miyado M., Umezawa A., Miyado K.Mol. Reprod. Dev. 75:150-155(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details