Recombinant Mouse CD70 antigen(Cd70)

SKU: CSB-CF004954MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O55237

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPEEGRPCPWVRWSGTAFQRQWPWLLLVVFITVFCCWFHCSGLLSKQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

Protein Names:Recommended name: CD70 antigen Alternative name(s): CD27 ligand Short name= CD27-L Tumor necrosis factor ligand superfamily member 7 CD_antigen= CD70

Gene Names:Name:Cd70 Synonyms:Cd27l, Cd27lg, Tnfsf7

Expression Region:1-195

Sequence Info:full length protein