Gene Bio Systems
Recombinant Mouse Carboxylesterase 1C(Ces1c),partial
Recombinant Mouse Carboxylesterase 1C(Ces1c),partial
SKU:CSB-EP338557MOe1
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P23953
Gene Names: Ces1c
Organism: Mus musculus (Mouse)
AA Sequence: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
Expression Region: 19-550aa
Sequence Info: Partial
Source: E.coli
Tag Info: NO-tagged
MW: 58.6 kDa
Alternative Name(s): Liver carboxylesterase N Lung surfactant convertase PES-N
Relevance: Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.
Reference: "Proteome-wide characterization of N-glycosylation events by diagonal chromatography." Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K. J. Proteome Res. 5:2438-2447(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
