Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse C-C motif chemokine 21c (Ccl21c)

Recombinant Mouse C-C motif chemokine 21c (Ccl21c)

SKU:P86793

Regular price €1.036,95 EUR
Regular price Sale price €1.036,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P86793

Gene Names: Ccl21c

Alternative Name(s): (6Ckine)(Beta-chemokine exodus-2)(Small-inducible cytokine A21c)(Thymus-derived chemotactic agent 4)(TCA4)

Abbreviation: Recombinant Mouse Ccl21c protein

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 24-133aa

Protein Length: Full Length of Mature Protein

Tag Info: Tag-Free

Target Protein Sequence: SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

MW: 12.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Potent mesangial cell chemoattractant. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs.

Reference: "Differential regulation of CCL21 in lymphoid/nonlymphoid tissues for effectively attracting T cells to peripheral tissues." Lo J.C., Chin R.K., Lee Y., Kang H.S., Wang Y., Weinstock J.V., Banks T., Ware C.F., Franzoso G., Fu Y.X. J Clin Invest 112: 1495-1505(2003)

Function:

View full details