Gene Bio Systems
Recombinant Mouse Bone morphogenetic protein 3(Bmp3)
Recombinant Mouse Bone morphogenetic protein 3(Bmp3)
SKU:CSB-EP002739MO
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Developmental Biology
Uniprot ID:Q8BHE5
Gene Names:Bmp3
Organism:Mus musculus (Mouse)
AA Sequence:QWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR
Expression Region:359-468aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:C-terminal myc-tagged
MW:13.9 kDa
Alternative Name(s):Bmp3Bone morphogenetic protein 3; BMP-3
Relevance:Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.
Reference:"Immunolocalization of Bone Morphogenetic Protein-2 and -3 and Osteogenic Protein-1 during murine tooth root morphogenesis and in other craniofacial structures." Thomadakis G., Ramoshebi L.N., Crooks J., Rueger D.C., Ripamonti U. Eur. J. Oral Sci. 107:368-377(1999)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.
Involvement in disease:
Subcellular Location:Secreted
Protein Families:TGF-beta family
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=136461
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:110075
STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000031278
OMIM Database Link:
Lead Time Guidance:3-7 business days
