Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Bcl-2 homologous antagonist-killer(Bak1)

Recombinant Mouse Bcl-2 homologous antagonist-killer(Bak1)

SKU:CSB-CF002548MO

Regular price €1.331,95 EUR
Regular price Sale price €1.331,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O08734

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGRPPANPEMDNL PLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGI SWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNL RRDPILTVMVIFGVVLLGQFVVHRFFRS

Protein Names:Recommended name: Bcl-2 homologous antagonist/killer Alternative name(s): Apoptosis regulator BAK

Gene Names:Name:Bak1 Synonyms:Bak

Expression Region:1-208

Sequence Info:Full length protein

View full details