Recombinant Mouse B-lymphocyte antigen CD20(Ms4a1),partial

CSB-YP015007MO(F1)

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P19437

Gene Names: Ms4a1

Organism: Mus musculus (Mouse)

AA Sequence: ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Expression Region: 132-291aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 20.1 kDa

Alternative Name(s): B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20

Relevance: This protein may be involved in the regulation of B-cell activation and proliferation.

Reference: The oligomeric nature of the murine Fc epsilon RII/CD23. Implications for function.Dierks S.E., Bartlett W.C., Edmeades R.L., Gould H.J., Rao M., Conrad D.H.J. Immunol. 150:2372-2382(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.