
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P19437
Gene Names: Ms4a1
Organism: Mus musculus (Mouse)
AA Sequence: ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Expression Region: 132-291aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 20.1 kDa
Alternative Name(s): B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20
Relevance: This protein may be involved in the regulation of B-cell activation and proliferation.
Reference: The oligomeric nature of the murine Fc epsilon RII/CD23. Implications for function.Dierks S.E., Bartlett W.C., Edmeades R.L., Gould H.J., Rao M., Conrad D.H.J. Immunol. 150:2372-2382(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse B-lymphocyte antigen CD20(Ms4a1),partial
- Regular price
- €635,95 EUR
- Sale price
- €635,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse B-lymphocyte antigen CD20(Ms4a1) ,partial
- Regular price
- €637,95 EUR
- Sale price
- €637,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Membrane-spanning 4-domains subfamily A member 3(Ms4a3)
- Regular price
- €1.096,95 EUR
- Sale price
- €1.096,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Membrane-spanning 4-domains subfamily A member 6D(Ms4a6d)
- Regular price
- €1.121,95 EUR
- Sale price
- €1.121,95 EUR
- Regular price
-
- Unit price
- per
Sold out