Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse ATP synthase protein 8(Mtatp8)

Recombinant Mouse ATP synthase protein 8(Mtatp8)

SKU:CSB-CF015071MO

Regular price €1.345,95 EUR
Regular price Sale price €1.345,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P03930

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPQLDTSTWFITIISSMITLFILFQLKVSSQTFPLAPSPKSLTTMKVKTPWELKWTKIYLPHSLPQQ

Protein Names:Recommended name: ATP synthase protein 8 Alternative name(s): A6L F-ATPase subunit 8

Gene Names:Name:Mtatp8 Synonyms:Atp8, mt-Atp8

Expression Region:1-67

Sequence Info:full length protein

View full details