Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2),partial

Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2),partial

CSB-EP002208MO1
Regular price
€632,95 EUR
Sale price
€632,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P24721

Gene Names: Asgr2

Organism: Mus musculus (Mouse)

AA Sequence: QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH

Expression Region: 80-301aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 29.9 kDa

Alternative Name(s): Hepatic lectin 2 Short name: HL-2 Short name: mHL-2 Asgr-2

Relevance: Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.

Reference: "Mouse asialoglycoprotein receptor cDNA sequence: conservation of receptor genes during mammalian evolution." Sanford J.P., Doyle D. Biochim. Biophys. Acta 1087:259-261(1990)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share