
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: Apoe
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P08226
AA Sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
Tag info: N-terminal 6xHis-tagged
Expression Region: 19-311aa
Protein length: Full Length
MW: 36 kDa
Alternative Name(s):
Relevance: Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron rnant) of hepatic tissues.
Reference: Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications.Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P.Biochim. Biophys. Acta 1764:1363-1371(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Apolipoprotein E(Apoe)
- Regular price
- €780,95 EUR
- Sale price
- €780,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Apolipoprotein E(Apoe)
- Regular price
- €782,95 EUR
- Sale price
- €782,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabbit Apolipoprotein E(APOE),partial
- Regular price
- €920,95 EUR
- Sale price
- €920,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabbit Apolipoprotein E(APOE),partial
- Regular price
- €920,95 EUR
- Sale price
- €920,95 EUR
- Regular price
-
- Unit price
- per
Sold out