
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Cardiovascular
Uniprot ID: Q3TMQ6
Gene Names: Ang4
Organism: Mus musculus (Mouse)
AA Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
Expression Region: 25-144aa
Sequence Info: Full Length of Mature Protein
Source: Yeast
Tag Info: N-terminal 6xHis-sumostar-tagged
MW: 29.9 kDa
Alternative Name(s):
Relevance: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro)
Reference: "Angiogenins: a new class of microbicidal proteins involved in innate immunity." Hooper L.V., Stappenbeck T.S., Hong C.V., Gordon J.I. Nat. Immunol. 4:269-273(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Angiogenin-4(Ang4)
- Regular price
- €778,95 EUR
- Sale price
- €778,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Angiogenin-4(Ang4)
- Regular price
- €778,95 EUR
- Sale price
- €778,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Angiogenin-4(Ang4)
- Regular price
- €781,95 EUR
- Sale price
- €781,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Angiogenin-4(Ang4)
- Regular price
- €781,95 EUR
- Sale price
- €781,95 EUR
- Regular price
-
- Unit price
- per
Sold out