Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Alpha-beta hydrolase domain-containing protein 11(Abhd11)

Recombinant Mouse Alpha-beta hydrolase domain-containing protein 11(Abhd11)

SKU:CSB-YP811717MO

Regular price €867,95 EUR
Regular price Sale price €867,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: Q8K4F5

Gene Names: Abhd11

Organism: Mus musculus (Mouse)

AA Sequence: MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA

Expression Region: 1-307aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 35.6 kDa

Alternative Name(s): Williams-Beuren syndrome chromosomal region 21 protein homolog

Relevance:

Reference: "Identification of additional transcripts in the Williams-Beuren syndrome critical region."Merla G., Ucla C., Guipponi M., Reymond A.Hum. Genet. 110:429-438(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details