
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O70200
Gene Names: Aif1
Organism: Mus musculus (Mouse)
AA Sequence: SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP
Expression Region: 2-147aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 20.8 kDa
Alternative Name(s): Ionized calcium-binding adapter molecule 1
Relevance: Actin-binding protein that enhances mbrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.
Reference: X-ray structures of the microglia/macrophage-specific protein Iba1 from human and mouse demonstrate novel molecular conformation change induced by calcium binding.Yamada M., Ohsawa K., Imai Y., Kohsaka S., Kamitori S.J. Mol. Biol. 364:449-457(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Allograft inflammatory factor 1(AIF1),partial
- Regular price
- €500,95 EUR
- Sale price
- €500,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Allograft inflammatory factor 1(Aif1)
- Regular price
- €637,95 EUR
- Sale price
- €637,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Allograft inflammatory factor 1(Aif1)
- Regular price
- €639,95 EUR
- Sale price
- €639,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Insulin-like growth factor-binding protein 1(Igfbp1)
- Regular price
- €637,95 EUR
- Sale price
- €637,95 EUR
- Regular price
-
- Unit price
- per
Sold out