Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse ADP-ribosylation factor-like protein 6-interacting protein 6(Arl6ip6)

Recombinant Mouse ADP-ribosylation factor-like protein 6-interacting protein 6(Arl6ip6)

SKU:CSB-CF805886MO

Regular price €1.515,95 EUR
Regular price Sale price €1.515,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8BH07

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFVESWRFAGARRRRQVTPGPATRPGYSDYTQGDSWGEGEGDEDEGCDQVARDLRAEFS ARASSETKRAPLLPRVGDGSPVLPDKRNGIFPATAAKRTQARRWPIQALSILCSLLFAVL LAFLLAIAYMIVKELHAENLKNEDDIHTGLLGFWSLLIISLTAGLSCCSFSWTVTYFDSF EPGMFPPTPLSPARFKKLTGHSFHMGYSMAILNGIVAALTVAWCLM

Protein Names:Recommended name: ADP-ribosylation factor-like protein 6-interacting protein 6 Short name= ARL-6-interacting protein 6 Short name= Aip-6

Gene Names:Name:Arl6ip6

Expression Region:1-226

Sequence Info:full length protein

View full details