Recombinant Mouse Adipogenin(Adig)

CSB-CF001365MO

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8R400

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKYPLVPLVSDLTLSFLVFWLCLPVALLLFLTIVWLHFLLSQESKEDDSDLCFNWEPWSK RPSECGCEETFPGEEDGLHW

Protein Names:Recommended name: Adipogenin Alternative name(s): Small adipocyte factor 1 Short name= SMAF-1

Gene Names:Name:Adig Synonyms:Smaf1

Expression Region:1-80

Sequence Info:full length protein