Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 4(Ptplad2)

Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 4(Ptplad2)

SKU:CSB-CF019020MO

Regular price €1.508,95 EUR
Regular price Sale price €1.508,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:A2AKM2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGPSVLPAWLQPRYRKNVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLV MRVCQSISLLELLHIYIGIESNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFIL WNLLDMVRYTYSMLSVIGTSYAALTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTN STVLPFDLSTCFPYVLKLYLMMLFIGMYFTYSHLYTERKDFLRVFSVKQKNV

Protein Names:Recommended name: 3-hydroxyacyl-CoA dehydratase 4 Short name= HACD4 EC= 4.2.1.- Alternative name(s): Protein tyrosine phosphatase-like protein PTPLAD2 Protein-tyrosine phosphatase-like A domain-containing protein 2

Gene Names:Name:Ptplad2 Synonyms:hacd4

Expression Region:1-232

Sequence Info:Full length protein

View full details