Gene Bio Systems
Recombinant Moorella thermoacetica UPF0756 membrane protein Moth_0120(Moth_0120)
Recombinant Moorella thermoacetica UPF0756 membrane protein Moth_0120(Moth_0120)
SKU:CSB-CF647767MUG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Moorella thermoacetica (strain ATCC 39073)
Uniprot NO.:Q2RM80
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSAATVILILLMLLGILGRSNVIAAAAAFLLLLQFTSLQRFYPILERRALEAGLIFLVVS VLVPFASGRVAPRDMLQSFVSLPGLIAIASGIIATHMNCQGLELLQRFPQMMIGMVIGSI IGVAFFGGIPVGPLMAGGIAALLVHLMAWLR
Protein Names:Recommended name: UPF0756 membrane protein Moth_0120
Gene Names:Ordered Locus Names:Moth_0120
Expression Region:1-151
Sequence Info:full length protein
