Skip to product information
1 of 1

Gene Bio Systems

Recombinant Moloney murine leukemia virus Glycosylated Gag polyprotein(gag)

Recombinant Moloney murine leukemia virus Glycosylated Gag polyprotein(gag)

SKU:CSB-CF840805MJAA

Regular price €1.480,95 EUR
Regular price Sale price €1.480,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Moloney murine leukemia virus (strain neuropathogenic variant ts1-92b) (MoMLV)

Uniprot NO.:Q8UN02

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETN VAMSFIWQSAPDIGRKLERLEDLKNKTLGDLVREAERIFNKRETPEEREERIRRETEEKE ERRRTEDEQKEKERDRRRHREMSKLLATVVSGQRQDRQGGERRRSQLDRDQCAYCKEKGH WAKDCPKKPRGPRGPRPQTSLLTLDD

Protein Names:Recommended name: Glycosylated Gag polyprotein Short name= Pr80gag Alternative name(s): Glyco-gag gp80gag Cleaved into the following 2 chains: 1. Nextended-MA-p12 2. CA-NC

Gene Names:Name:gag

Expression Region:430-626

Sequence Info:full length protein

View full details