Gene Bio Systems
Recombinant Metridium senile ATP synthase protein 8(MTATP8)
Recombinant Metridium senile ATP synthase protein 8(MTATP8)
SKU:CSB-CF015071MTL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Metridium senile (Brown sea anemone) (Frilled sea anemone)
Uniprot NO.:O47493
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMPQLETATYLTQYRWTLIALFLLFSFLVVSVLPAVKTNFLIRRSIGAGWTGAPKTSDLN KGPASLWSWDKI
Protein Names:Recommended name: ATP synthase protein 8 Alternative name(s): A6L F-ATPase subunit 8
Gene Names:Name:MTATP8 Synonyms:ATP8, ATPASE8
Expression Region:1-72
Sequence Info:full length protein