Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methylobacterium chloromethanicum Large-conductance mechanosensitive channel(mscL)

Recombinant Methylobacterium chloromethanicum Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF484883MSY

Regular price €1.423,95 EUR
Regular price Sale price €1.423,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methylobacterium chloromethanicum (strain CM4 / NCIMB 13688)

Uniprot NO.:B7KPQ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLEEFKKFALRGNVVDLAVGVIIGAAFGAIVNSLVQDVIMPIIGAVTGGLDFSNYYIPLS SKVQDGMPYAEAKKVGAVIGYGQFLTLAVNFTIIAFVLFMVIRAMNVLKSREEAKPKPVA EVPADVKLLGEIRDLLAARRV

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:Mchl_2802

Expression Region:1-141

Sequence Info:full length protein

View full details