Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methylobacillus flagellatus Methylamine utilization protein mauE(mauE)

Recombinant Methylobacillus flagellatus Methylamine utilization protein mauE(mauE)

SKU:CSB-CF703491MAAN

Regular price €1.470,95 EUR
Regular price Sale price €1.470,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

Uniprot NO.:Q50414

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSWLINDPTAAVLASLFIGIVLAAAAIPKFRHPDEFQGVVANYKLLPSFLVAPVAKLLPL VELLCAVALMIPPAREIAACVAAGLFIVFALALAINVGRGRTHIDCGCVRRPTSMSRIGM FHVMRAIALAGVSLYVAAVPVEFSRISIESGLMGLAAAAMLALLYMGADMLVGFPNSKND LLKGNTND

Protein Names:Recommended name: Methylamine utilization protein mauE

Gene Names:Name:mauE Ordered Locus Names:Mfla_0549

Expression Region:1-188

Sequence Info:full length protein

View full details