Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanothermobacter thermautotrophicus Probable biotin transporter BioY(bioY)

Recombinant Methanothermobacter thermautotrophicus Probable biotin transporter BioY(bioY)

SKU:CSB-CF522961MSR

Regular price €1.440,95 EUR
Regular price Sale price €1.440,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Uniprot NO.:O26990

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSGVILGRYWGGLSQLIYVIIGAAGVPWFADMSGGPEVLLGATGGYLLGFILAALLLGHF VDRHIRARKFTPMLGLMTIANFGLIYIPGLVVLGLWSLKTQGTLPGPWELLVMGLLPFIP GDILKITGAAALTRAITPKEPYGEEIDIQKAEGWRVP

Protein Names:Recommended name: Probable biotin transporter BioY

Gene Names:Name:bioY Ordered Locus Names:MTH_905

Expression Region:1-157

Sequence Info:full length protein

View full details