Recombinant Methanothermobacter marburgensis Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A(ehaA)

SKU: CSB-CF892099MSQ

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)

Uniprot NO.:Q9UXQ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIIHVTYLSGYITGIISSIIISAILGLPLAPERPARHSWTPSAIFPAPIIAMGLVAICIK LGVTGMYGGVDLGVVSGLLAALMTAYFLEDIFPRPEDL

Protein Names:Recommended name: Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A

Gene Names:Name:ehaA Ordered Locus Names:MTBMA_c07840

Expression Region:1-98

Sequence Info:full length protein